Lineage for d1wexa_ (1wex A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) 
Family d.58.7.1: Canonical RBD [54929] (32 proteins) 
Protein Heterogeneous nuclear ribonucleoprotein L-like [117951] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [117952] (1 PDB entry) 
Domain d1wexa_: 1wex A: [114568]
Structural genomics target
Details for d1wexa_
PDB Entry: 1wex (more details)
PDB Description: solution structure of rrm domain in protein bab28521
SCOP Domain Sequences for d1wexa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus)}
gssgssgshhkvsvspvvhvrglcesvveadlvealekfgticyvmmmpfkrqalvefen
idsakecvtfaadvpvyiagqqaffnystskritrpgnsgpssg
SCOP Domain Coordinates for d1wexa_:
Click to download the PDB-style file with coordinates for d1wexa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wexa_:
- d1wexa_ is new in SCOP 1.71
- d1wexa_ appears in SCOP 1.73
- d1wexa_ appears in the current release, SCOPe 2.08, called d1wexa1
View in 3D