![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Heterogeneous nuclear ribonucleoprotein L-like [117951] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117952] (1 PDB entry) Uniprot Q921F4 116-207 |
![]() | Domain d1wexa1: 1wex A:8-98 [114568] Other proteins in same PDB: d1wexa2, d1wexa3 Structural genomics target |
PDB Entry: 1wex (more details)
SCOPe Domain Sequences for d1wexa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wexa1 d.58.7.1 (A:8-98) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} shhkvsvspvvhvrglcesvveadlvealekfgticyvmmmpfkrqalvefenidsakec vtfaadvpvyiagqqaffnystskritrpgn
Timeline for d1wexa1: