SCOPe 2.06: Domain d1wewa1: 1wew A:8-72

Lineage for d1wewa1 (1wew A:8-72)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein Sumoylation ligase E3, SIZ1 [118344] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118345] (1 PDB entry)
   Uniprot Q680Q4 104-168

8. Domain d1wewa1: 1wew A:8-72 [114567]
   Other proteins in same PDB: d1wewa2, d1wewa3
   Structural genomics target
   complexed with zn

Details for d1wewa1

PDB Entry: 1wew

PDB Description: solution structure of phd domain in dna-binding family protein aam98074

PDB Compounds: (A:) DNA-binding family protein

SCOPe Domain Sequences for d1wewa1:

Sequence; same for both SEQRES and ATOM records:

>d1wewa1 g.50.1.2 (A:8-72) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
edpfqpeikvrcvcgnsletdsmiqcedprchvwqhvgcvilpdkpmdgnpplpesfyce
icrlt

Timeline for d1wewa1:

• d1wewa1 first appeared in SCOP 1.71, called d1wewa_
  
• d1wewa1 was called d1wewa_ in SCOPe 2.05
  
• d1wewa1 appears in SCOPe 2.07
  
• d1wewa1 appears in the current release, SCOPe 2.08