SCOP 1.71: Domain d1wewa_: 1wew A:

Lineage for d1wewa_ (1wew A:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families)

5. Family g.50.1.2: PHD domain [57911] (12 proteins)

6. Protein Sumoylation ligase E3, SIZ1 [118344] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118345] (1 PDB entry)

8. Domain d1wewa_: 1wew A: [114567]
   Structural genomics target
   complexed with zn

Details for d1wewa_

PDB Entry: 1wew

PDB Description: solution structure of phd domain in dna-binding family protein aam98074

SCOP Domain Sequences for d1wewa_:

Sequence; same for both SEQRES and ATOM records:

>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana)}
gssgssgedpfqpeikvrcvcgnsletdsmiqcedprchvwqhvgcvilpdkpmdgnppl
pesfyceicrltsgpssg

Timeline for d1wewa_:

• d1wewa_ is new in SCOP 1.71
  
• d1wewa_ appears in SCOP 1.73
  
• d1wewa_ appears in the current release, SCOPe 2.08, called d1wewa1