SCOPe 2.08: Domain d1weua1: 1weu A:8-85

Lineage for d1weua1 (1weu A:8-85)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118335] (2 PDB entries)
   Uniprot Q8C0D7 188-245

8. Domain d1weua1: 1weu A:8-85 [114565]
   Other proteins in same PDB: d1weua2, d1weua3
   Structural genomics target; the extra N-terminal region (168-187) is unstructured
   complexed with zn

Details for d1weua1

PDB Entry: 1weu

PDB Description: solution structure of phd domain in ing1-like protein bac25009

PDB Compounds: (A:) inhibitor of growth family, member 4

SCOPe Domain Sequences for d1weua1:

Sequence; same for both SEQRES and ATOM records:

>d1weua1 g.50.1.2 (A:8-85) Inhibitor of growth protein 4, Ing4 {Mouse (Mus musculus) [TaxId: 10090]}
speygmpsvtfgsvhpsdvldmpvdpneptyclchqvsygemigcdnpdcsiewfhfacv
glttkprgkwfcprcsqe

Timeline for d1weua1:

• d1weua1 first appeared in SCOP 1.71, called d1weua_
  
• d1weua1 appears in SCOPe 2.07