Lineage for d1wesa_ (1wes A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967224Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1967225Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1967248Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 1967283Protein PHD Inhibitor of growth protein 2, Ing2 [118340] (1 species)
  7. 1967284Species Mouse (Mus musculus) [TaxId:10090] [118341] (1 PDB entry)
    Uniprot Q9ESK4 205-262
  8. 1967285Domain d1wesa_: 1wes A: [114564]
    Structural genomics target
    complexed with zn

Details for d1wesa_

PDB Entry: 1wes (more details)

PDB Description: solution structure of phd domain in inhibitor of growth family, member 1-like
PDB Compounds: (A:) inhibitor of growth family, member 1-like

SCOPe Domain Sequences for d1wesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgefaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycp
kcrgdsgpssg

SCOPe Domain Coordinates for d1wesa_:

Click to download the PDB-style file with coordinates for d1wesa_.
(The format of our PDB-style files is described here.)

Timeline for d1wesa_: