Class g: Small proteins [56992] (92 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein PHD Inhibitor of growth protein 2, Ing2 [118340] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [118341] (1 PDB entry) Uniprot Q9ESK4 205-262 |
Domain d1wesa_: 1wes A: [114564] Structural genomics target complexed with zn |
PDB Entry: 1wes (more details)
SCOPe Domain Sequences for d1wesa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgefaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycp kcrgdsgpssg
Timeline for d1wesa_: