SCOP 1.71: Domain d1wesa_: 1wes A:

Lineage for d1wesa_ (1wes A:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families)

5. Family g.50.1.2: PHD domain [57911] (12 proteins)

6. Protein PHD Inhibitor of growth protein 2, Ing2 [118340] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118341] (1 PDB entry)

8. Domain d1wesa_: 1wes A: [114564]
   Structural genomics target
   complexed with zn

Details for d1wesa_

PDB Entry: 1wes

PDB Description: solution structure of phd domain in inhibitor of growth family, member 1-like

SCOP Domain Sequences for d1wesa_:

Sequence; same for both SEQRES and ATOM records:

>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus)}
gssgssgefaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycp
kcrgdsgpssg

Timeline for d1wesa_:

• d1wesa_ is new in SCOP 1.71
  
• d1wesa_ appears in SCOP 1.73
  
• d1wesa_ appears in the current release, SCOPe 2.08, called d1wesa1