Lineage for d1wesa1 (1wes A:8-65)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037886Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 3037922Protein PHD Inhibitor of growth protein 2, Ing2 [118340] (1 species)
  7. 3037923Species Mouse (Mus musculus) [TaxId:10090] [118341] (1 PDB entry)
    Uniprot Q9ESK4 205-262
  8. 3037924Domain d1wesa1: 1wes A:8-65 [114564]
    Other proteins in same PDB: d1wesa2, d1wesa3
    Structural genomics target
    complexed with zn

Details for d1wesa1

PDB Entry: 1wes (more details)

PDB Description: solution structure of phd domain in inhibitor of growth family, member 1-like
PDB Compounds: (A:) inhibitor of growth family, member 1-like

SCOPe Domain Sequences for d1wesa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wesa1 g.50.1.2 (A:8-65) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]}
efaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycpkcrgd

SCOPe Domain Coordinates for d1wesa1:

Click to download the PDB-style file with coordinates for d1wesa1.
(The format of our PDB-style files is described here.)

Timeline for d1wesa1: