SCOPe 2.08: Domain d1wesa1: 1wes A:8-65

Lineage for d1wesa1 (1wes A:8-65)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein PHD Inhibitor of growth protein 2, Ing2 [118340] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118341] (1 PDB entry)
   Uniprot Q9ESK4 205-262

8. Domain d1wesa1: 1wes A:8-65 [114564]
   Other proteins in same PDB: d1wesa2, d1wesa3
   Structural genomics target
   complexed with zn

Details for d1wesa1

PDB Entry: 1wes

PDB Description: solution structure of phd domain in inhibitor of growth family, member 1-like

PDB Compounds: (A:) inhibitor of growth family, member 1-like

SCOPe Domain Sequences for d1wesa1:

Sequence; same for both SEQRES and ATOM records:

>d1wesa1 g.50.1.2 (A:8-65) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]}
efaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycpkcrgd

Timeline for d1wesa1:

• d1wesa1 first appeared in SCOP 1.71, called d1wesa_
  
• d1wesa1 appears in SCOPe 2.07