SCOPe 2.07: Domain d1weqa1: 1weq A:8-79

Lineage for d1weqa1 (1weq A:8-79)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein PHD finger protein 7 (NYD-SP6) [118338] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118339] (1 PDB entry)
   Uniprot Q9DAG9 232-304

8. Domain d1weqa1: 1weq A:8-79 [114563]
   Other proteins in same PDB: d1weqa2, d1weqa3
   Structural genomics target
   complexed with zn

Details for d1weqa1

PDB Entry: 1weq

PDB Description: solution structure of phd domain in phd finger protein 7

PDB Compounds: (A:) PHD finger protein 7

SCOPe Domain Sequences for d1weqa1:

Sequence; same for both SEQRES and ATOM records:

>d1weqa1 g.50.1.2 (A:8-79) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]}
elepgafselyqryrhcdapiclyeqgrdsfedegrwrlilcatcgshgthrdcsslrpn
skkwecneclpa

Timeline for d1weqa1:

• d1weqa1 first appeared in SCOP 1.71, called d1weqa_
  
• d1weqa1 appears in SCOPe 2.06
  
• d1weqa1 appears in the current release, SCOPe 2.08