Class g: Small proteins [56992] (98 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein PHD finger protein 7 (NYD-SP6) [118338] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [118339] (1 PDB entry) Uniprot Q9DAG9 232-304 |
Domain d1weqa1: 1weq A:8-79 [114563] Other proteins in same PDB: d1weqa2, d1weqa3 Structural genomics target complexed with zn |
PDB Entry: 1weq (more details)
SCOPe Domain Sequences for d1weqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1weqa1 g.50.1.2 (A:8-79) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} elepgafselyqryrhcdapiclyeqgrdsfedegrwrlilcatcgshgthrdcsslrpn skkwecneclpa
Timeline for d1weqa1: