Lineage for d1weqa1 (1weq A:8-79)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264355Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2264356Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2264379Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2264403Protein PHD finger protein 7 (NYD-SP6) [118338] (1 species)
  7. 2264404Species Mouse (Mus musculus) [TaxId:10090] [118339] (1 PDB entry)
    Uniprot Q9DAG9 232-304
  8. 2264405Domain d1weqa1: 1weq A:8-79 [114563]
    Other proteins in same PDB: d1weqa2, d1weqa3
    Structural genomics target
    complexed with zn

Details for d1weqa1

PDB Entry: 1weq (more details)

PDB Description: solution structure of phd domain in phd finger protein 7
PDB Compounds: (A:) PHD finger protein 7

SCOPe Domain Sequences for d1weqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weqa1 g.50.1.2 (A:8-79) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]}
elepgafselyqryrhcdapiclyeqgrdsfedegrwrlilcatcgshgthrdcsslrpn
skkwecneclpa

SCOPe Domain Coordinates for d1weqa1:

Click to download the PDB-style file with coordinates for d1weqa1.
(The format of our PDB-style files is described here.)

Timeline for d1weqa1: