Class g: Small proteins [56992] (92 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein PHD finger protein 8 [118336] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [118337] (1 PDB entry) Uniprot Q80TJ7 1-66 |
Domain d1wepa_: 1wep A: [114562] Structural genomics target complexed with zn |
PDB Entry: 1wep (more details)
SCOPe Domain Sequences for d1wepa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgmalvpvyclcrqpynvnhfmiecglcqdwfhgscvgieeenavdidiyhcpdc eavfgpsimknwhsgpssg
Timeline for d1wepa_: