SCOPe 2.03: Domain d1wepa_: 1wep A:

Lineage for d1wepa_ (1wep A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein PHD finger protein 8 [118336] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118337] (1 PDB entry)
   Uniprot Q80TJ7 1-66

8. Domain d1wepa_: 1wep A: [114562]
   Structural genomics target
   complexed with zn

Details for d1wepa_

PDB Entry: 1wep

PDB Description: solution structure of phd domain in phf8

PDB Compounds: (A:) phf8

SCOPe Domain Sequences for d1wepa_:

Sequence; same for both SEQRES and ATOM records:

>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmalvpvyclcrqpynvnhfmiecglcqdwfhgscvgieeenavdidiyhcpdc
eavfgpsimknwhsgpssg

Timeline for d1wepa_:

• d1wepa_ first appeared in SCOP 1.71
  
• d1wepa_ appears in SCOPe 2.02
  
• d1wepa_ appears in SCOPe 2.04
  
• d1wepa_ appears in the current release, SCOPe 2.08, called d1wepa1