Lineage for d1wepa1 (1wep A:8-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037886Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 3037913Protein PHD finger protein 8 [118336] (1 species)
  7. 3037914Species Mouse (Mus musculus) [TaxId:10090] [118337] (1 PDB entry)
    Uniprot Q80TJ7 1-66
  8. 3037915Domain d1wepa1: 1wep A:8-73 [114562]
    Other proteins in same PDB: d1wepa2, d1wepa3
    Structural genomics target
    complexed with zn

Details for d1wepa1

PDB Entry: 1wep (more details)

PDB Description: solution structure of phd domain in phf8
PDB Compounds: (A:) phf8

SCOPe Domain Sequences for d1wepa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wepa1 g.50.1.2 (A:8-73) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]}
malvpvyclcrqpynvnhfmiecglcqdwfhgscvgieeenavdidiyhcpdceavfgps
imknwh

SCOPe Domain Coordinates for d1wepa1:

Click to download the PDB-style file with coordinates for d1wepa1.
(The format of our PDB-style files is described here.)

Timeline for d1wepa1: