![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (14 proteins) |
![]() | Protein PHD finger protein 8 [118336] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118337] (1 PDB entry) Uniprot Q80TJ7 1-66 |
![]() | Domain d1wepa1: 1wep A:8-73 [114562] Other proteins in same PDB: d1wepa2, d1wepa3 Structural genomics target complexed with zn |
PDB Entry: 1wep (more details)
SCOPe Domain Sequences for d1wepa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wepa1 g.50.1.2 (A:8-73) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} malvpvyclcrqpynvnhfmiecglcqdwfhgscvgieeenavdidiyhcpdceavfgps imknwh
Timeline for d1wepa1: