Lineage for d1wekd_ (1wek D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151503Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2151504Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) (S)
  5. 2151505Family c.129.1.1: MoCo carrier protein-like [102406] (6 protein domains)
    Pfam PF03641
  6. 2151524Protein Hypothetical protein TT1465 (TTHA1644) [117565] (1 species)
  7. 2151525Species Thermus thermophilus [TaxId:274] [117566] (1 PDB entry)
    Uniprot Q5SHT6
  8. 2151529Domain d1wekd_: 1wek D: [114556]
    Structural genomics target
    complexed with po4

Details for d1wekd_

PDB Entry: 1wek (more details), 2.2 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1465 from Thermus thermophilus HB8
PDB Compounds: (D:) hypothetical protein TT1465

SCOPe Domain Sequences for d1wekd_:

Sequence, based on SEQRES records: (download)

>d1wekd_ c.129.1.1 (D:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}
kkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlg
ralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryff
vrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaf
lrdqkavgpedlqlfrltdepeevvqalkaeap

Sequence, based on observed residues (ATOM records): (download)

>d1wekd_ c.129.1.1 (D:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}
kkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlg
ralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpnpyqthalslryffvrkvl
fvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrdqk
avgpedlqlfrltdepeevvqalkaeap

SCOPe Domain Coordinates for d1wekd_:

Click to download the PDB-style file with coordinates for d1wekd_.
(The format of our PDB-style files is described here.)

Timeline for d1wekd_: