Lineage for d1wekc_ (1wek C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922908Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
    Pfam PF03641
  6. 2922927Protein Hypothetical protein TT1465 (TTHA1644) [117565] (1 species)
  7. 2922928Species Thermus thermophilus [TaxId:274] [117566] (1 PDB entry)
    Uniprot Q5SHT6
  8. 2922931Domain d1wekc_: 1wek C: [114555]
    Structural genomics target
    complexed with po4

Details for d1wekc_

PDB Entry: 1wek (more details), 2.2 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1465 from Thermus thermophilus HB8
PDB Compounds: (C:) hypothetical protein TT1465

SCOPe Domain Sequences for d1wekc_:

Sequence, based on SEQRES records: (download)

>d1wekc_ c.129.1.1 (C:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}
pkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrl
gralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryf
fvrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwla
flrdqkavgpedlqlfrltdepeevvqalka

Sequence, based on observed residues (ATOM records): (download)

>d1wekc_ c.129.1.1 (C:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}
pkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrl
gralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpnpyqthalslryffvrkv
lfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrdq
kavgpedlqlfrltdepeevvqalka

SCOPe Domain Coordinates for d1wekc_:

Click to download the PDB-style file with coordinates for d1wekc_.
(The format of our PDB-style files is described here.)

Timeline for d1wekc_: