SCOPe 2.05: Domain d1wekb_: 1wek B:

Lineage for d1wekb_ (1wek B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (3 families)

5. Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
   Pfam PF03641

6. Protein Hypothetical protein TT1465 (TTHA1644) [117565] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117566] (1 PDB entry)
   Uniprot Q5SHT6

8. Domain d1wekb_: 1wek B: [114554]
   Structural genomics target
   complexed with po4

Details for d1wekb_

PDB Entry: 1wek, 2.2 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1465 from Thermus thermophilus HB8

PDB Compounds: (B:) hypothetical protein TT1465

SCOPe Domain Sequences for d1wekb_:

Sequence; same for both SEQRES and ATOM records:

>d1wekb_ c.129.1.1 (B:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}
lidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgral
aeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryffvrk
vlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrd
qkavgpedlqlfrltdepeevvqalka

Timeline for d1wekb_:

• d1wekb_ first appeared in SCOP 1.71
  
• d1wekb_ appears in SCOPe 2.04
  
• d1wekb_ appears in SCOPe 2.06
  
• d1wekb_ appears in the current release, SCOPe 2.08