Lineage for d1wekb_ (1wek B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1631228Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 1631229Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) (S)
  5. 1631230Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
    Pfam PF03641
  6. 1631249Protein Hypothetical protein TT1465 (TTHA1644) [117565] (1 species)
  7. 1631250Species Thermus thermophilus [TaxId:274] [117566] (1 PDB entry)
    Uniprot Q5SHT6
  8. 1631252Domain d1wekb_: 1wek B: [114554]
    Structural genomics target
    complexed with po4

Details for d1wekb_

PDB Entry: 1wek (more details), 2.2 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1465 from Thermus thermophilus HB8
PDB Compounds: (B:) hypothetical protein TT1465

SCOPe Domain Sequences for d1wekb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wekb_ c.129.1.1 (B:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}
lidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgral
aeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryffvrk
vlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrd
qkavgpedlqlfrltdepeevvqalka

SCOPe Domain Coordinates for d1wekb_:

Click to download the PDB-style file with coordinates for d1wekb_.
(The format of our PDB-style files is described here.)

Timeline for d1wekb_: