![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
![]() | Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) ![]() |
![]() | Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins) Pfam PF03641 |
![]() | Protein Hypothetical protein TT1465 (TTHA1644) [117565] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117566] (1 PDB entry) Uniprot Q5SHT6 |
![]() | Domain d1wekb_: 1wek B: [114554] Structural genomics target complexed with po4 |
PDB Entry: 1wek (more details), 2.2 Å
SCOPe Domain Sequences for d1wekb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wekb_ c.129.1.1 (B:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]} lidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgral aeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryffvrk vlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrd qkavgpedlqlfrltdepeevvqalka
Timeline for d1wekb_: