Lineage for d1weka_ (1wek A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595507Fold c.129: Putative lysine decarboxylase [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 595508Superfamily c.129.1: Putative lysine decarboxylase [102405] (1 family) (S)
  5. 595509Family c.129.1.1: Putative lysine decarboxylase [102406] (5 proteins)
    Pfam 03641
  6. 595520Protein Hypothetical protein TT1465 (TTHA1644) [117565] (1 species)
  7. 595521Species Thermus thermophilus [TaxId:274] [117566] (1 PDB entry)
  8. 595522Domain d1weka_: 1wek A: [114553]

Details for d1weka_

PDB Entry: 1wek (more details), 2.2 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1465 from Thermus thermophilus HB8

SCOP Domain Sequences for d1weka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weka_ c.129.1.1 (A:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus}
plidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgra
laeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryffvr
kvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflr
dqkavgpedlqlfrltdepeevvqalka

SCOP Domain Coordinates for d1weka_:

Click to download the PDB-style file with coordinates for d1weka_.
(The format of our PDB-style files is described here.)

Timeline for d1weka_: