Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.129: Putative lysine decarboxylase [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
Superfamily c.129.1: Putative lysine decarboxylase [102405] (1 family) |
Family c.129.1.1: Putative lysine decarboxylase [102406] (5 proteins) Pfam 03641 |
Protein Hypothetical protein TT1887 (TTHA0294) [117563] (1 species) |
Species Thermus thermophilus [TaxId:274] [117564] (1 PDB entry) |
Domain d1weha_: 1weh A: [114551] |
PDB Entry: 1weh (more details), 1.8 Å
SCOP Domain Sequences for d1weha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1weha_ c.129.1.1 (A:) Hypothetical protein TT1887 (TTHA0294) {Thermus thermophilus} mrllavfvssrlspedplyarwvrygevlaeegfglacggyqggmealargvkakgglvv gvtapaffperrgpnpfvdlelpaatlpqrigrlldlgagylalpggvgtlaelvlawnl lylrrgvgrplavdpywlgllkahgeiapedvgllrvvadeedlrrflrsl
Timeline for d1weha_: