SCOPe 2.08: Domain d1weha_: 1weh A:

Lineage for d1weha_ (1weh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (6 families)

5. Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
   Pfam PF03641

6. Protein Hypothetical protein TT1887 (TTHA0294) [117563] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117564] (1 PDB entry)
   Uniprot Q5SLJ9

8. Domain d1weha_: 1weh A: [114551]
   Structural genomics target

Details for d1weha_

PDB Entry: 1weh, 1.8 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1887 from Thermus thermophilus HB8

PDB Compounds: (A:) Conserved hypothetical protein TT1887

SCOPe Domain Sequences for d1weha_:

Sequence; same for both SEQRES and ATOM records:

>d1weha_ c.129.1.1 (A:) Hypothetical protein TT1887 (TTHA0294) {Thermus thermophilus [TaxId: 274]}
mrllavfvssrlspedplyarwvrygevlaeegfglacggyqggmealargvkakgglvv
gvtapaffperrgpnpfvdlelpaatlpqrigrlldlgagylalpggvgtlaelvlawnl
lylrrgvgrplavdpywlgllkahgeiapedvgllrvvadeedlrrflrsl

Timeline for d1weha_:

• d1weha_ first appeared in SCOP 1.71
  
• d1weha_ appears in SCOPe 2.07