Class g: Small proteins [56992] (85 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) |
Family g.50.1.2: PHD domain [57911] (12 proteins) |
Protein PHD finger protein At1g33420 [118330] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118331] (1 PDB entry) |
Domain d1weea_: 1wee A: [114550] Structural genomics target complexed with zn |
PDB Entry: 1wee (more details)
SCOP Domain Sequences for d1weea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gssgssgmergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflc frcielsgpssg
Timeline for d1weea_: