Lineage for d1weea_ (1wee A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625240Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 625241Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) (S)
  5. 625264Family g.50.1.2: PHD domain [57911] (12 proteins)
  6. 625288Protein PHD finger protein At1g33420 [118330] (1 species)
  7. 625289Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118331] (1 PDB entry)
  8. 625290Domain d1weea_: 1wee A: [114550]
    Structural genomics target
    complexed with zn

Details for d1weea_

PDB Entry: 1wee (more details)

PDB Description: solution structure of phd domain in phd finger family protein

SCOP Domain Sequences for d1weea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana)}
gssgssgmergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflc
frcielsgpssg

SCOP Domain Coordinates for d1weea_:

Click to download the PDB-style file with coordinates for d1weea_.
(The format of our PDB-style files is described here.)

Timeline for d1weea_: