Lineage for d1weea1 (1wee A:8-66)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037886Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 3037916Protein PHD finger protein At1g33420 [118330] (1 species)
  7. 3037917Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118331] (1 PDB entry)
    Uniprot Q9C810 595-653
  8. 3037918Domain d1weea1: 1wee A:8-66 [114550]
    Other proteins in same PDB: d1weea2, d1weea3
    Structural genomics target
    complexed with zn

Details for d1weea1

PDB Entry: 1wee (more details)

PDB Description: solution structure of phd domain in phd finger family protein
PDB Compounds: (A:) PHD finger family protein

SCOPe Domain Sequences for d1weea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weea1 g.50.1.2 (A:8-66) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflcfrciel

SCOPe Domain Coordinates for d1weea1:

Click to download the PDB-style file with coordinates for d1weea1.
(The format of our PDB-style files is described here.)

Timeline for d1weea1: