Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein PHD finger protein At1g33420 [118330] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118331] (1 PDB entry) Uniprot Q9C810 595-653 |
Domain d1weea1: 1wee A:8-66 [114550] Other proteins in same PDB: d1weea2, d1weea3 Structural genomics target complexed with zn |
PDB Entry: 1wee (more details)
SCOPe Domain Sequences for d1weea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1weea1 g.50.1.2 (A:8-66) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} mergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflcfrciel
Timeline for d1weea1: