Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins) an RNA-binding domain |
Protein Tudor and KH domain containing protein, Tdrkh [117912] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117913] (1 PDB entry) Uniprot Q80VL1 118-208 |
Domain d1we8a_: 1we8 A: [114548] Structural genomics target; 2nd KH domain |
PDB Entry: 1we8 (more details)
SCOP Domain Sequences for d1we8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} gssgssgiltentpvfeqlsvpqrsvgriigrggetirsickasgakitcdkesegtlll srlikisgtqkevaaakhlilekvsedeelrkriahsasgpssg
Timeline for d1we8a_: