Lineage for d1we7a_ (1we7 A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) 
Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
Pfam 00240
Protein Splicing factor 3 subunit 1, C-terminal domain [117799] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [117800] (1 PDB entry) 
Domain d1we7a_: 1we7 A: [114547]
Structural genomics target
Details for d1we7a_
PDB Entry: 1we7 (more details)
PDB Description: solution structure of ubiquitin-like domain in sf3a120
SCOP Domain Sequences for d1we7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we7a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Mouse (Mus musculus)}
gssgssgtedslmpeeeflrrnkgpvsikvqvpnmqdktewklngqglvftlpltdqvsv
ikvkiheatgmpagkqklqyegifikdsnslayynmasgavihlalkersgpssg
SCOP Domain Coordinates for d1we7a_:
Click to download the PDB-style file with coordinates for d1we7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1we7a_:
- d1we7a_ is new in SCOP 1.71
- d1we7a_ appears in SCOP 1.73
- d1we7a_ appears in the current release, SCOPe 2.08, called d1we7a1
View in 3D