Lineage for d1we6a1 (1we6 A:8-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931466Protein Splicing factor 3 subunit 1, C-terminal domain [117799] (3 species)
  7. 2931471Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117801] (1 PDB entry)
    SQ Q8RXF1 683-780; T5E21.13/At1g14650
  8. 2931472Domain d1we6a1: 1we6 A:8-105 [114546]
    Other proteins in same PDB: d1we6a2, d1we6a3
    Structural genomics target

Details for d1we6a1

PDB Entry: 1we6 (more details)

PDB Description: solution structure of ubiquitin-like domain in splicing factor aal91182
PDB Compounds: (A:) splicing factor, putative

SCOPe Domain Sequences for d1we6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we6a1 d.15.1.1 (A:8-105) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kfdesalvpedqflaqhpgpatirvskpnendgqfmeitvqslsenvgslkekiageiqi
pankqklsgkagflkdnmslahynvgageiltlslrer

SCOPe Domain Coordinates for d1we6a1:

Click to download the PDB-style file with coordinates for d1we6a1.
(The format of our PDB-style files is described here.)

Timeline for d1we6a1: