Lineage for d1we1d_ (1we1 D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777764Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 777800Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 777863Species Synechocystis sp. [TaxId:1143] [117032] (1 PDB entry)
    Uniprot P72849 2-223
  8. 777867Domain d1we1d_: 1we1 D: [114545]
    complexed with cl, hem, ioh, po4

Details for d1we1d_

PDB Entry: 1we1 (more details), 2.5 Å

PDB Description: Crystal structure of heme oxygenase-1 from cyanobacterium Synechocystis sp. PCC6803 in complex with heme
PDB Compounds: (D:) Heme oxygenase 1

SCOP Domain Sequences for d1we1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we1d_ a.132.1.1 (D:) Heme oxygenase-1 (HO-1) {Synechocystis sp. [TaxId: 1143]}
vnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakfkd
hpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapellva
hsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpidq
ataerivdeandafamnmkmfnelegnlikaigimvfnslt

SCOP Domain Coordinates for d1we1d_:

Click to download the PDB-style file with coordinates for d1we1d_.
(The format of our PDB-style files is described here.)

Timeline for d1we1d_: