Lineage for d1we1b_ (1we1 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732664Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2732753Species Synechocystis sp. [TaxId:1143] [117032] (1 PDB entry)
    Uniprot P72849 2-223
  8. 2732755Domain d1we1b_: 1we1 B: [114543]
    complexed with cl, hem, ipa, po4

Details for d1we1b_

PDB Entry: 1we1 (more details), 2.5 Å

PDB Description: Crystal structure of heme oxygenase-1 from cyanobacterium Synechocystis sp. PCC6803 in complex with heme
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1we1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we1b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Synechocystis sp. [TaxId: 1143]}
svnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakfk
dhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapellv
ahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpid
qataerivdeandafamnmkmfnelegnlikaigimvfnslt

SCOPe Domain Coordinates for d1we1b_:

Click to download the PDB-style file with coordinates for d1we1b_.
(The format of our PDB-style files is described here.)

Timeline for d1we1b_: