Lineage for d1wdya_ (1wdy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006593Protein RNase L, 2-5a-dependent ribonuclease [117879] (1 species)
  7. 3006594Species Human (Homo sapiens) [TaxId:9606] [117880] (1 PDB entry)
    Uniprot Q05823 21-305
  8. 3006595Domain d1wdya_: 1wdy A: [114541]
    complexed with 25a
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1wdya_

PDB Entry: 1wdy (more details), 1.8 Å

PDB Description: crystal structure of ribonuclease
PDB Compounds: (A:) 2-5A-dependent ribonuclease

SCOPe Domain Sequences for d1wdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]}
aavednhllikavqnedvdlvqqllegganvnfqeeeggwtplhnavqmsredivelllr
hgadpvlrkkngatpfllaaiagsvkllklflskgadvnecdfygftafmeaavygkvka
lkflykrganvnlrrktkedqerlrkggatalmdaaekghvevlkilldemgadvnacdn
mgrnalihallssddsdveaithllldhgadvnvrgergktplilavekkhlglvqrlle
qehieindtdsdgktalllavelklkkiaellckrgastdcgdlv

SCOPe Domain Coordinates for d1wdya_:

Click to download the PDB-style file with coordinates for d1wdya_.
(The format of our PDB-style files is described here.)

Timeline for d1wdya_: