Lineage for d1wdvb_ (1wdv B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972065Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 2972066Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 2972067Family d.116.1.1: YbaK/ProRS associated domain [55827] (4 proteins)
    Pfam PF04073
  6. 2972068Protein Hypothetical protein APE2540 [118085] (1 species)
  7. 2972069Species Aeropyrum pernix [TaxId:56636] [118086] (1 PDB entry)
    Uniprot Q9Y8U3
  8. 2972071Domain d1wdvb_: 1wdv B: [114540]
    Structural genomics targe

Details for d1wdvb_

PDB Entry: 1wdv (more details), 1.7 Å

PDB Description: Crystal structure of hypothetical protein APE2540
PDB Compounds: (B:) hypothetical protein APE2540

SCOPe Domain Sequences for d1wdvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdvb_ d.116.1.1 (B:) Hypothetical protein APE2540 {Aeropyrum pernix [TaxId: 56636]}
ekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvipg
dkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkkvy
ggggrenallefsprelveatgavvadvse

SCOPe Domain Coordinates for d1wdvb_:

Click to download the PDB-style file with coordinates for d1wdvb_.
(The format of our PDB-style files is described here.)

Timeline for d1wdvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wdva_