![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.27: Hypothetical protein TT1808 (TTHA1514) [117628] (1 protein) Pfam PF05685; DUF820 |
![]() | Protein Hypothetical protein TT1808 (TTHA1514) [117629] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117630] (1 PDB entry) Uniprot Q5SI60 |
![]() | Domain d1wdja_: 1wdj A: [114536] Structural genomics target |
PDB Entry: 1wdj (more details), 2 Å
SCOPe Domain Sequences for d1wdja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdja_ c.52.1.27 (A:) Hypothetical protein TT1808 (TTHA1514) {Thermus thermophilus [TaxId: 274]} plvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwne erglgvvfdsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsas qdpeelrakmgiylrngvllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfal slpplw
Timeline for d1wdja_: