Lineage for d1wdja_ (1wdj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882650Family c.52.1.27: Hypothetical protein TT1808 (TTHA1514) [117628] (1 protein)
    Pfam PF05685; DUF820
  6. 2882651Protein Hypothetical protein TT1808 (TTHA1514) [117629] (1 species)
  7. 2882652Species Thermus thermophilus [TaxId:274] [117630] (1 PDB entry)
    Uniprot Q5SI60
  8. 2882653Domain d1wdja_: 1wdj A: [114536]
    Structural genomics target

Details for d1wdja_

PDB Entry: 1wdj (more details), 2 Å

PDB Description: Crystal structure of TT1808 from Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TT1808

SCOPe Domain Sequences for d1wdja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdja_ c.52.1.27 (A:) Hypothetical protein TT1808 (TTHA1514) {Thermus thermophilus [TaxId: 274]}
plvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwne
erglgvvfdsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsas
qdpeelrakmgiylrngvllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfal
slpplw

SCOPe Domain Coordinates for d1wdja_:

Click to download the PDB-style file with coordinates for d1wdja_.
(The format of our PDB-style files is described here.)

Timeline for d1wdja_: