Lineage for d1wdia_ (1wdi A:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885838Fold e.53: QueA-like [111336] (1 superfamily)
    2 domains; d1 (1-64,174-335) [alpha/beta; 3 layers, a/b/a; mixed beta sheet of 9 strands, order: 219863457; strands 1, 5 and 8 are antiparallel to the rest]; d2 (65-142) [all-beta; barrel, closed (n=6, S=10); greek-key; topologically similar to the split barrel fold ((50474))
    2 domains; d1 (1-64,174-335) [alpha/beta; 3 layers, a/b/a; mixed beta sheet of 9 strands, order: 219863457; strands 1, 5 and 8 are antiparallel to the rest]; d2 (65-142) [all-beta; barrel, closed (n=6, S=10); greek-key; topologically similar to the split barrel fold ((50474))
  4. 885839Superfamily e.53.1: QueA-like [111337] (1 family) (S)
  5. 885840Family e.53.1.1: QueA-like [111338] (1 protein)
    Pfam PF02547
  6. 885841Protein Queuosine biosynthesis protein queA [111339] (2 species)
  7. 885845Species Thermus thermophilus [TaxId:274] [118201] (1 PDB entry)
    Uniprot Q5SMH0
  8. 885846Domain d1wdia_: 1wdi A: [114535]
    Structural genomics target
    complexed with cit

Details for d1wdia_

PDB Entry: 1wdi (more details), 2.1 Å

PDB Description: Crystal Structure Of TT0907 From Thermus Thermophilus HB8
PDB Compounds: (A:) hypothetical protein TT0907

SCOP Domain Sequences for d1wdia_:

Sequence, based on SEQRES records: (download)

>d1wdia_ e.53.1.1 (A:) Queuosine biosynthesis protein queA {Thermus thermophilus [TaxId: 274]}
egleaydyhlppeqiaqegveprdmarlmvvyregpfrvahkrvrdlpeflrpgdvlvfn
eskviparllarkptggkveillvrerspglweallgparkappgtrllllspkdlapvp
glqaevvaveedgvrllrfqgdlvahleevgevplppyikakipmeryqtvyarrpgsva
aptaglhftpellerlremgvelrfltlhvgpgtfrpvkgdpekhemhaepyaipeevae
avnrakaegrrvvavgttvvralesayregvgvvagegetrlfirppytfkvvdalftnf
hlprstllmlvaaflgrertleayrlavaegyrfyslgdamlil

Sequence, based on observed residues (ATOM records): (download)

>d1wdia_ e.53.1.1 (A:) Queuosine biosynthesis protein queA {Thermus thermophilus [TaxId: 274]}
egleaydyhlppeqiaqegveprdmarlmvvyregpfrvahkrvrdlpeflrpgdvlvfn
eskviparllarkptggkveillvrerallgparkappgtrllllspkdlapvpglqaev
vaveedlvahleevgevpaaptaglhftpellerlremgvelrfltlhvgpgtfrpmhae
pyaipeevaeavnrakaegrrvvavgttvvralesayregvgvvagegetrlfirppytf
kvvdalftnfhlprstllmlvaaflgrertleayrlavaegyrfyslgdamlil

SCOP Domain Coordinates for d1wdia_:

Click to download the PDB-style file with coordinates for d1wdia_.
(The format of our PDB-style files is described here.)

Timeline for d1wdia_: