SCOPe 2.06: Domain d1wdea_: 1wde A:

Lineage for d1wdea_ (1wde A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein Diphthine synthase, DphB [102684] (3 species)
   diphthamide biosynthesis methyltransferase

7. Species Aeropyrum pernix [TaxId:56636] [117735] (1 PDB entry)
   SQ Q9YDI2; APE0931

8. Domain d1wdea_: 1wde A: [114534]
   Structural genomics target

Details for d1wdea_

PDB Entry: 1wde, 2 Å

PDB Description: Crystal structure of the conserved hypothetical protein APE0931 from Aeropyrum pernix K1

PDB Compounds: (A:) Probable diphthine synthase

SCOPe Domain Sequences for d1wdea_:

Sequence; same for both SEQRES and ATOM records:

>d1wdea_ c.90.1.1 (A:) Diphthine synthase, DphB {Aeropyrum pernix [TaxId: 56636]}
eavtlllvgwgyapgmqtlealdavrradvvyvesytmpgsswlyksvveaagearvvea
srrdleersreivsraldavvavvtagdpmvatthsslaaealeagvavryipgvsgvqa
argatmlsfyrfggtvtlpgpwrgvtpisvarriylnlcaglhttalldvdergvqlspg
qgvsllleadreyareagapallarlpsvlveagaggghrvlywsslerlstadveggvy
siviparlsgveewllaaasgqrrpleydrsvyetveenckkgvymepv

Timeline for d1wdea_:

• d1wdea_ first appeared in SCOP 1.71
  
• d1wdea_ appears in SCOPe 2.05
  
• d1wdea_ appears in SCOPe 2.07
  
• d1wdea_ appears in the current release, SCOPe 2.08