SCOP 1.73: Domain d1wdds_: 1wdd S:

Lineage for d1wdds_ (1wdd S:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [118017] (1 PDB entry)

8. Domain d1wdds_: 1wdd S: [114532]
   Other proteins in same PDB: d1wdda1, d1wdda2, d1wdde1, d1wdde2

Details for d1wdds_

PDB Entry: 1wdd, 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate

PDB Compounds: (S:) Ribulose bisphosphate carboxylase small chain C

SCOP Domain Sequences for d1wdds_:

Sequence; same for both SEQRES and ATOM records:

>d1wdds_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
gc

Timeline for d1wdds_:

• d1wdds_ first appeared in SCOP 1.71
  
• d1wdds_ appears in SCOP 1.75
  
• d1wdds_ appears in the current release, SCOPe 2.08