Lineage for d1wdds_ (1wdd S:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605700Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 605701Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 605702Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 605703Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (7 species)
  7. 605743Species Rice (Oryza sativa) [TaxId:4530] [118017] (1 PDB entry)
  8. 605744Domain d1wdds_: 1wdd S: [114532]
    Other proteins in same PDB: d1wdda1, d1wdda2, d1wdde1, d1wdde2

Details for d1wdds_

PDB Entry: 1wdd (more details), 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1wdds_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdds_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa)}
mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
gc

SCOP Domain Coordinates for d1wdds_:

Click to download the PDB-style file with coordinates for d1wdds_.
(The format of our PDB-style files is described here.)

Timeline for d1wdds_: