![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (10 species) |
![]() | Species Rice (Oryza sativa) [TaxId:4530] [117976] (1 PDB entry) |
![]() | Domain d1wdde2: 1wdd E:12-150 [114531] Other proteins in same PDB: d1wdda1, d1wdde1, d1wdds_, d1wddw_ complexed with cap, gol, mg, mme |
PDB Entry: 1wdd (more details), 1.35 Å
SCOP Domain Sequences for d1wdde2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdde2 d.58.9.1 (E:12-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa)} gfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt dgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalr alrledlripptysktfqg
Timeline for d1wdde2:
![]() Domains from other chains: (mouse over for more information) d1wdda1, d1wdda2, d1wdds_, d1wddw_ |