Lineage for d1wdda2 (1wdd A:11-150)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604204Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 604205Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 604206Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (10 species)
  7. 604266Species Rice (Oryza sativa) [TaxId:4530] [117976] (1 PDB entry)
  8. 604267Domain d1wdda2: 1wdd A:11-150 [114529]
    Other proteins in same PDB: d1wdda1, d1wdde1, d1wdds_, d1wddw_

Details for d1wdda2

PDB Entry: 1wdd (more details), 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1wdda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdda2 d.58.9.1 (A:11-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa)}
vgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvw
tdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkal
ralrledlripptysktfqg

SCOP Domain Coordinates for d1wdda2:

Click to download the PDB-style file with coordinates for d1wdda2.
(The format of our PDB-style files is described here.)

Timeline for d1wdda2: