Lineage for d1wdda1 (1wdd A:151-475)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573365Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 573366Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 573367Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (10 species)
  7. 573427Species Rice (Oryza sativa) [TaxId:4530] [117390] (1 PDB entry)
  8. 573428Domain d1wdda1: 1wdd A:151-475 [114528]
    Other proteins in same PDB: d1wdda2, d1wdde2, d1wdds_, d1wddw_

Details for d1wdda1

PDB Entry: 1wdd (more details), 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1wdda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa)}
pphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenvnsqp
fmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdyl
tggftantslahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhihagt
vvgklegeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpal
teifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiirsack
wspelaaaceiwkaikfefepvdkl

SCOP Domain Coordinates for d1wdda1:

Click to download the PDB-style file with coordinates for d1wdda1.
(The format of our PDB-style files is described here.)

Timeline for d1wdda1: