Lineage for d1wcsa2 (1wcs A:1-406)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326287Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1326288Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1326520Protein Trypanosoma sialidase [82164] (2 species)
  7. 1326541Species Trypanosoma rangeli [TaxId:5698] [82165] (10 PDB entries)
    Uniprot O44049 20-653
  8. 1326550Domain d1wcsa2: 1wcs A:1-406 [114523]
    Other proteins in same PDB: d1wcsa1
    mutant

Details for d1wcsa2

PDB Entry: 1wcs (more details), 2.8 Å

PDB Description: a mutant of trypanosoma rangeli sialidase displaying trans-sialidase activity
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1wcsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcsa2 b.68.1.1 (A:1-406) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]}
aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
sfdnsfietavkysvddgatwntqiaiknsrassvsrvvdptvivkgnklyilvgsfnkt
rnywtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
egkliinnrvdynrrlvyessdmgktwvealgtlshvwtnsptsnqpdcqssfvavtieg
krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

SCOPe Domain Coordinates for d1wcsa2:

Click to download the PDB-style file with coordinates for d1wcsa2.
(The format of our PDB-style files is described here.)

Timeline for d1wcsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wcsa1