Lineage for d1wcsa1 (1wcs A:413-634)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664233Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 664234Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 664254Species Trypanosoma rangeli [TaxId:5698] [82040] (10 PDB entries)
  8. 664264Domain d1wcsa1: 1wcs A:413-634 [114522]
    Other proteins in same PDB: d1wcsa2
    mutant

Details for d1wcsa1

PDB Entry: 1wcs (more details), 2.8 Å

PDB Description: a mutant of trypanosoma rangeli sialidase displaying trans-sialidase activity
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d1wcsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcsa1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]}
acgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvar
qgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrply
gaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyigg
prskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOP Domain Coordinates for d1wcsa1:

Click to download the PDB-style file with coordinates for d1wcsa1.
(The format of our PDB-style files is described here.)

Timeline for d1wcsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wcsa2