SCOPe 2.02: Domain d1wcmj_: 1wcm J:

Lineage for d1wcmj_ (1wcm J:)

1. Root: SCOPe 2.02

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1wcmj_: 1wcm J: [114519]
   complexed with mg, zn

Details for d1wcmj_

PDB Entry: 1wcm, 3.8 Å

PDB Description: complete 12-subunit rna polymerase ii at 3.8 ang

PDB Compounds: (J:) DNA-directed RNA polymerases I, II and III 8.3 kda polypeptide

SCOPe Domain Sequences for d1wcmj_:

Sequence; same for both SEQRES and ATOM records:

>d1wcmj_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1wcmj_:

• d1wcmj_ first appeared in SCOP 1.71
  
• d1wcmj_ appears in SCOPe 2.01
  
• d1wcmj_ appears in SCOPe 2.03
  
• d1wcmj_ appears in the current release, SCOPe 2.08