Lineage for d1wcmh_ (1wcm H:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649260Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2649261Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2649262Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2649263Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2649264Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2649279Domain d1wcmh_: 1wcm H: [114517]
    complexed with mg, zn

Details for d1wcmh_

PDB Entry: 1wcm (more details), 3.8 Å

PDB Description: complete 12-subunit rna polymerase ii at 3.8 ang
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOPe Domain Sequences for d1wcmh_:

Sequence, based on SEQRES records: (download)

>d1wcmh_ i.8.1.1 (H:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d1wcmh_ i.8.1.1 (H:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d1wcmh_:

Click to download the PDB-style file with coordinates for d1wcmh_.
(The format of our PDB-style files is described here.)

Timeline for d1wcmh_: