Lineage for d1wcmg_ (1wcm G:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 755052Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 755053Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 755054Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 755055Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 755056Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (18 PDB entries)
  8. 755119Domain d1wcmg_: 1wcm G: [114516]

Details for d1wcmg_

PDB Entry: 1wcm (more details), 3.8 Å

PDB Description: complete 12-subunit rna polymerase ii at 3.8 ang
PDB Compounds: (G:) DNA-directed RNA polymerase II 19 kd polypeptide

SCOP Domain Sequences for d1wcmg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcmg_ i.8.1.1 (G:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai

SCOP Domain Coordinates for d1wcmg_:

Click to download the PDB-style file with coordinates for d1wcmg_.
(The format of our PDB-style files is described here.)

Timeline for d1wcmg_: