SCOPe 2.07: Domain d1wcja_: 1wcj A:

Lineage for d1wcja_ (1wcj A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.2: PaaD-like [117922] (3 proteins)
   Pfam PF01883; DUF59

6. Protein Hypothetical protein TM0487 [117923] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [117924] (2 PDB entries)
   Uniprot Q9WYV7

8. Domain d1wcja_: 1wcj A: [114509]
   Structural genomics target

Details for d1wcja_

PDB Entry: 1wcj

PDB Description: conserved hypothetical protein tm0487 from thermotoga maritima

PDB Compounds: (A:) hypothetical protein tm0487

SCOPe Domain Sequences for d1wcja_:

Sequence; same for both SEQRES and ATOM records:

>d1wcja_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]}
mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv

Timeline for d1wcja_:

• d1wcja_ first appeared in SCOP 1.71
  
• d1wcja_ appears in SCOPe 2.06
  
• d1wcja_ appears in the current release, SCOPe 2.08