Lineage for d1wcja_ (1wcj A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602714Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 602813Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (2 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 602821Family d.52.8.2: PaaD-like [117922] (1 protein)
    Pfam 01883; DUF59
  6. 602822Protein Hypothetical protein TM0487 [117923] (1 species)
  7. 602823Species Thermotoga maritima [TaxId:243274] [117924] (2 PDB entries)
  8. 602825Domain d1wcja_: 1wcj A: [114509]
    Structural genomics target

Details for d1wcja_

PDB Entry: 1wcj (more details)

PDB Description: conserved hypothetical protein tm0487 from thermotoga maritima

SCOP Domain Sequences for d1wcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcja_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima}
mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv

SCOP Domain Coordinates for d1wcja_:

Click to download the PDB-style file with coordinates for d1wcja_.
(The format of our PDB-style files is described here.)

Timeline for d1wcja_: