Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (2 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.2: PaaD-like [117922] (1 protein) Pfam 01883; DUF59 |
Protein Hypothetical protein TM0487 [117923] (1 species) |
Species Thermotoga maritima [TaxId:243274] [117924] (2 PDB entries) |
Domain d1wcja_: 1wcj A: [114509] Structural genomics target |
PDB Entry: 1wcj (more details)
SCOP Domain Sequences for d1wcja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcja_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima} mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv
Timeline for d1wcja_: