Lineage for d1wcja_ (1wcj A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. Family d.52.8.2: PaaD-like [117922] (3 proteins)
    Pfam PF01883; DUF59
  6. Protein Hypothetical protein TM0487 [117923] (1 species)
  7. Species Thermotoga maritima [TaxId:2336] [117924] (2 PDB entries)
    Uniprot Q9WYV7
  8. Domain d1wcja_: 1wcj A: [114509]
    Structural genomics target

Details for d1wcja_

PDB Entry: 1wcj (more details)

PDB Description: conserved hypothetical protein tm0487 from thermotoga maritima
PDB Compounds: (A:) hypothetical protein tm0487

SCOPe Domain Sequences for d1wcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcja_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]}
mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv

SCOPe Domain Coordinates for d1wcja_ are not available.

Timeline for d1wcja_: