SCOPe 2.08: Domain d1wcha_: 1wch A:

Lineage for d1wcha_ (1wch A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) [117581] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117582] (1 PDB entry)
   Uniprot Q12923 2170-2477 # structure of a PDZ domain (1361-1456) is also known (50169)

8. Domain d1wcha_: 1wch A: [114508]
   complexed with po4

Details for d1wcha_

PDB Entry: 1wch, 1.85 Å

PDB Description: crystal structure of ptpl1 human tyrosine phosphatase mutated in colorectal cancer - evidence for a second phosphotyrosine substrate recognition pocket

PDB Compounds: (A:) protein tyrosine phosphatase, non-receptor type 13

SCOPe Domain Sequences for d1wcha_:

Sequence; same for both SEQRES and ATOM records:

>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]}
hsfltndelavlpvvkvlpsgkytganlksvirvlrglldqgipskelenlqelkpldqc
ligqtkenrrknryknilpydatrvplgdeggyinasfikipvgkeefvyiacqgplptt
vgdfwqmiweqkstviammtqevegekikcqrywpnilgkttmvsnrlrlalvrmqqlkg
fvvramtlediqtrevrhishlnftawpdhdtpsqpddlltfisymrhihrsgpiithcs
agigrsgtlicidvvlglisqdldfdisdlvrcmrlqrhgmvqtedqyifcyqvilyvlt
rlqaeeeq

Timeline for d1wcha_:

• d1wcha_ first appeared in SCOP 1.71
  
• d1wcha_ appears in SCOPe 2.07