SCOP 1.75: Domain d1wc9a_: 1wc9 A:

Lineage for d1wc9a_ (1wc9 A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (3 families)

5. Family d.278.1.2: TRAPP components [118076] (2 proteins)
   Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold

6. Protein Trafficking protein particle complex subunit 3, Bet3 homolog [118077] (1 species)
   covalently linked long fatty acid occupies the ligand-binding cavity

7. Species Mouse (Mus musculus) [TaxId:10090] [118078] (3 PDB entries)
   Uniprot O55013 9-173

8. Domain d1wc9a_: 1wc9 A: [114507]
   complexed with gol, myr

Details for d1wc9a_

PDB Entry: 1wc9, 1.6 Å

PDB Description: the crystal structure of truncated mouse bet3p

PDB Compounds: (A:) trafficking protein particle complex subunit3

SCOP Domain Sequences for d1wc9a_:

Sequence; same for both SEQRES and ATOM records:

>d1wc9a_ d.278.1.2 (A:) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
retadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnll
cgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirrie

Timeline for d1wc9a_:

• d1wc9a_ first appeared in SCOP 1.71
  
• d1wc9a_ appears in SCOP 1.73
  
• d1wc9a_ appears in SCOPe 2.01
  
• d1wc9a_ appears in the current release, SCOPe 2.08