![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
![]() | Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (3 families) ![]() |
![]() | Family d.278.1.2: TRAPP components [118076] (2 proteins) Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold |
![]() | Protein Trafficking protein particle complex subunit 3, Bet3 homolog [118077] (1 species) covalently linked long fatty acid occupies the ligand-binding cavity |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118078] (3 PDB entries) Uniprot O55013 9-173 |
![]() | Domain d1wc9a_: 1wc9 A: [114507] complexed with gol, myr |
PDB Entry: 1wc9 (more details), 1.6 Å
SCOP Domain Sequences for d1wc9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wc9a_ d.278.1.2 (A:) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]} kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf retadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnll cgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirrie
Timeline for d1wc9a_: