Lineage for d1wc9a_ (1wc9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009508Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 3009509Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 3009560Family d.278.1.2: TRAPP components [118076] (3 proteins)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. 3009561Protein Trafficking protein particle complex subunit 3, Bet3 homolog [118077] (1 species)
    covalently linked long fatty acid occupies the ligand-binding cavity
  7. 3009562Species Mouse (Mus musculus) [TaxId:10090] [118078] (3 PDB entries)
    Uniprot O55013 9-173
  8. 3009563Domain d1wc9a_: 1wc9 A: [114507]
    complexed with gol, myr

Details for d1wc9a_

PDB Entry: 1wc9 (more details), 1.6 Å

PDB Description: the crystal structure of truncated mouse bet3p
PDB Compounds: (A:) trafficking protein particle complex subunit3

SCOPe Domain Sequences for d1wc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wc9a_ d.278.1.2 (A:) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
retadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnll
cgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirrie

SCOPe Domain Coordinates for d1wc9a_:

Click to download the PDB-style file with coordinates for d1wc9a_.
(The format of our PDB-style files is described here.)

Timeline for d1wc9a_: